HORDB

ID: hor004623
Uniprot ID: O49519
Protein name: CLAVATA3/ESR (CLE)-related protein 2
Gene name: CLE2
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE2p]: Mostly expressed in roots and seedlings, and, to a lower extent, in apex.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0007267 cell-cell signaling; GO:0030154 cell differentiation; GO:0045165 cell fate commitment
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: SRPLEGARVGVKVRGLSPSIEATSPTVEDDQAAGSHGKSPERLSPGGPDPQHH
Length: 53(23-75)
Propeptide: MAKLSFTFCFLLFLLLSSIAAGSRPLEGARVGVKVRGLSPSIEATSPTVEDDQAAGSHGKSPERLSPGGPDPQHH
Signal peptide: MAKLSFTFCFLLFLLLSSIAAG
Modification: T45 Hydroxyproline;T48 Hydroxyproline
Glycosylation: T48 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: Extracellular signal peptide that regulates cell fate. May act with CLV1 as a ligand-receptor pair in a signal transduction pathway, coordinating growth between adjacent meristematic regions. {ECO:0000269|PubMed:16489133, ECO:0000269|PubMed:19525968}.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004623_AF2.pdb

hor004623_ESM.pdb

Mass:	638062	Formula:	C230H373N75O79
Absent amino acids:	CFMNWY	Common amino acids:	GPS
pI:	6.8	Basic residues:	9
Polar residues:	16	Hydrophobic residues:	12
Hydrophobicity:	-90.57	Boman Index:	-12852
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	58.87
Instability Index:	6310.94	Extinction Coefficient cystines:	0
Absorbance 280nm:	0