General Information

  • ID:  hor004622
  • Uniprot ID:  Q941C5
  • Protein name:  CLE44p
  • Gene name:  CLE44
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE44p]: Mostly expressed in flowers and leaves. Widely expressed along the vascular strands. In roots and hypocotyls, present in endodermal cells as well as cells in the phloem and the adjacent pericycle.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0033612 receptor serine/threonine kinase binding
  • GO BP:  GO:0010067 procambium histogenesis; GO:0010078 maintenance of root meristem identity; GO:0010087 phloem or xylem histogenesis; GO:0010088 phloem development; GO:0010089 xylem development; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation; GO:0090506 axillary shoot meristem initiation
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  HEVPSGPNPISN
  • Length:  12
  • Propeptide:  MATTIDQTSIKSLHFHQVIRLIITIIFLAFLFLIGPTSSMNHHLHESSSKNTMAPSKRFLLQPSTPSSSTMKMRPTAHPRRSGTSSSSARKRRREFRAEAHEVPSGPNPISN
  • Signal peptide:  MATTIDQTSIKSLHFHQVIRLIITIIFLAFLFLIGPTSS
  • Modification:  T4 Hydroxyproline;T7 Hydroxyproline
  • Glycosylation:  T7 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  7-7P->A: Impaired repression of tracheary element differentiation.

Activity

  • Function:  Extracellular signal peptide that regulates cell fate. May act with TDR as a ligand-receptor pair in a signal transduction pathway that represses tracheary element differentiation but promotes the formation of procambial cells adjacent to phloem cells in the veins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  2mie(PDB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    2mie.pdbhor004622_AF2.pdbhor004622_ESM.pdb

Physical Information

Mass: 144370 Formula: C53H82N16O19
Absent amino acids: ACDFKLMQRTWY Common amino acids: P
pI: 5.36 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: -98.33 Boman Index: -2165
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 56.67
Instability Index: 3886.67 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18315543
  • Title:  Identification of a Biologically Active, Small, Secreted Peptide in Arabidopsis by in Silico Gene Screening, Followed by LC-MS-based Structure Analysis