HORDB

ID: hor004621
Uniprot ID: Q941C5
Protein name: CLAVATA3/ESR (CLE)-related protein 44
Gene name: CLE44
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE44p]: Mostly expressed in flowers and leaves. Widely expressed along the vascular strands. In roots and hypocotyls, present in endodermal cells as well as cells in the phloem and the adjacent pericycle.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0010067 procambium histogenesis; GO:0010078 maintenance of root meristem identity; GO:0010087 phloem or xylem histogenesis; GO:0010088 phloem development; GO:0010089 xylem development; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation; GO:0090506 axillary shoot meristem initiation
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: MNHHLHESSSKNTMAPSKRFLLQPSTPSSSTMKMRPTAHPRRSGTSSSSARKRRREFRAEAHEVPSGPNPISN
Length: 73
Propeptide: MATTIDQTSIKSLHFHQVIRLIITIIFLAFLFLIGPTSSMNHHLHESSSKNTMAPSKRFLLQPSTPSSSTMKMRPTAHPRRSGTSSSSARKRRREFRAEAHEVPSGPNPISN
Signal peptide: MATTIDQTSIKSLHFHQVIRLIITIIFLAFLFLIGPTSS
Modification: T65 Hydroxyproline;T68 Hydroxyproline
Glycosylation: T68 O-linked (Ara...) hydroxyproline
Mutagenesis: 68-68P->A: Impaired repression of tracheary element differentiation.

Function: Extracellular signal peptide that regulates cell fate. May act with TDR as a ligand-receptor pair in a signal transduction pathway that represses tracheary element differentiation but promotes the formation of procambial cells adjacent to phloem cells in the veins.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004621_AF2.pdb

hor004621_ESM.pdb

Mass:	943645	Formula:	C340H557N119O107S4
Absent amino acids:	CDWY	Common amino acids:	S
pI:	12.42	Basic residues:	18
Polar residues:	26	Hydrophobic residues:	12
Hydrophobicity:	-123.84	Boman Index:	-25296
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	32.19
Instability Index:	9368.22	Extinction Coefficient cystines:	0
Absorbance 280nm:	0