HORDB

ID: hor004620
Uniprot ID: Q9XF04
Protein name: MCLV3
Gene name: CLV3
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: First detected in heart stage embryos in a patch of cells between the developing cotyledons. In vegetative and inflorescence meristems, expressed in a small cone of cells at the meristem apex.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0002221 pattern recognition receptor signaling pathway; GO:0007166 cell surface receptor signaling pathway; GO:0009934 regulation of meristem structural organization; GO:0010074 maintenance of meristem identity; GO:0030154 cell differentiation; GO:0045087 innate immune response; GO:0048507 meristem development
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: RTVPSGPDPLHHH
Length: 13(70-82)
Propeptide: MDSKSFLLLLLLFCFLFLHDASDLTQAHAHVQGLSNRKMMMMKMESEWVGANGEAEKAKTKGLGLHEELRTVPSGPDPLHHHVNPPRQPRNNFQLP
Signal peptide: MDSKSFLLLLLLFCFLFLHDA
Modification: T4 Hydroxyproline;T7 Hydroxyproline
Glycosylation: T7 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: Activates a signal transduction cascade to restrict WUSCHEL (WUS) expression, inducing shoot and root meristem consumption as cells differentiated into other organs.
Mechanism: His-81 seems to be essential for the activity of MCLV3.[Isoform 2]: May be due to intron retention.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004620_AF2.pdb

hor004620_ESM.pdb

Mass:	166381	Formula:	C63H96N22O18
Absent amino acids:	ACEFIKMNQWY	Common amino acids:	HP
pI:	7.81	Basic residues:	4
Polar residues:	3	Hydrophobic residues:	2
Hydrophobicity:	-125.38	Boman Index:	-3369
Half-Life:	1 hour	Half-Life Yeast:	2 min
Half-Life E.Coli:	2 min	Aliphatic Index	52.31
Instability Index:	3306.15	Extinction Coefficient cystines:	0
Absorbance 280nm:	0