General Information

  • ID:  hor004620
  • Uniprot ID:  Q9XF04
  • Protein name:  MCLV3
  • Gene name:  CLV3
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  First detected in heart stage embryos in a patch of cells between the developing cotyledons. In vegetative and inflorescence meristems, expressed in a small cone of cells at the meristem apex.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0033612 receptor serine/threonine kinase binding
  • GO BP:  GO:0002221 pattern recognition receptor signaling pathway; GO:0007166 cell surface receptor signaling pathway; GO:0009934 regulation of meristem structural organization; GO:0010074 maintenance of meristem identity; GO:0030154 cell differentiation; GO:0045087 innate immune response; GO:0048507 meristem development
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  RTVPSGPDPLHHH
  • Length:  13(70-82)
  • Propeptide:  MDSKSFLLLLLLFCFLFLHDASDLTQAHAHVQGLSNRKMMMMKMESEWVGANGEAEKAKTKGLGLHEELRTVPSGPDPLHHHVNPPRQPRNNFQLP
  • Signal peptide:  MDSKSFLLLLLLFCFLFLHDA
  • Modification:  T4 Hydroxyproline;T7 Hydroxyproline
  • Glycosylation:  T7 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Activates a signal transduction cascade to restrict WUSCHEL (WUS) expression, inducing shoot and root meristem consumption as cells differentiated into other organs.
  • Mechanism:  His-81 seems to be essential for the activity of MCLV3.[Isoform 2]: May be due to intron retention.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9XF04-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004620_AF2.pdbhor004620_ESM.pdb

Physical Information

Mass: 166381 Formula: C63H96N22O18
Absent amino acids: ACEFIKMNQWY Common amino acids: HP
pI: 7.81 Basic residues: 4
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: -125.38 Boman Index: -3369
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 52.31
Instability Index: 3306.15 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19525968
  • Title:  A Glycopeptide Regulating Stem Cell Fate in Arabidopsis Thaliana