HORDB

ID: hor004616
Uniprot ID: Q7XAD0
Protein name: HypSys II
Gene name: NA
Organism: Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Family: Systemin family
Source: Plant
Expression: By wounding and methyl jasmonate in leaves. |Leaves.
Disease: NA
Comments: NA
Taxonomy: Solanum subgen. Lycopersicon (subgenus), Solanum (genus), Solaneae (tribe), Solanoideae (subfamily), Solanaceae (family), Solanales (order), lamiids, asterids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005102 signaling receptor binding; GO:0005179 hormone activity
GO BP: GO:0006952 defense response; GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: GRHDYVASPPPPKPQDEQRQ
Length: 20
Propeptide: MISFFRAFFLIIIISFLIFVGAQARTLLGNYHDDEMLIELKLESGNYGRTPYKTPPPPTSSSPTHQEIVNGRHDSVLPPPSPKTDPIIGQLTTITTTPHHDDTVAAPPVGGRHDYVASPPPPKPQDEQRQIIITSSSSTLPLQASY
Signal peptide: MISFFRAFFLIIIISFLIFVGAQA
Modification: T9 4-hydroxyproline;T10 4-hydroxyproline;T11 4-hydroxyproline;T12 4-hydroxyproline
Glycosylation: T9 O-linked (Ara...) hydroxyproline;T10 O-linked (Ara...) hydroxyproline;T11 O-linked (Ara...) hydroxyproline;T12 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: they are part of the wound signaling of tomato plants that activates defense against herbivores and pathogens
Mechanism: Cause an alkalinization of suspension-cultured cells and induce the synthesis of defensive proteinase inhibitor proteins
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004616_AF2.pdb

hor004616_ESM.pdb

Mass:	264156	Formula:	C99H152N32O32
Absent amino acids:	CFILMNTW	Common amino acids:	P
pI:	7.54	Basic residues:	4
Polar residues:	3	Hydrophobic residues:	2
Hydrophobicity:	-208	Boman Index:	-7767
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	19.5
Instability Index:	10474	Extinction Coefficient cystines:	1490
Absorbance 280nm:	78.42