HORDB

ID: hor004615
Uniprot ID: Q7XAD0
Protein name: HypSys III
Gene name: NA
Organism: Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Family: Systemin family
Source: Plant
Expression: By wounding and methyl jasmonate in leaves. |Leaves.
Disease: NA
Comments: NA
Taxonomy: Solanum subgen. Lycopersicon (subgenus), Solanum (genus), Solaneae (tribe), Solanoideae (subfamily), Solanaceae (family), Solanales (order), lamiids, asterids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005102 signaling receptor binding; GO:0005179 hormone activity
GO BP: GO:0006952 defense response; GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: GRHDSVLPPPSPKTD
Length: 15
Propeptide: MISFFRAFFLIIIISFLIFVGAQARTLLGNYHDDEMLIELKLESGNYGRTPYKTPPPPTSSSPTHQEIVNGRHDSVLPPPSPKTDPIIGQLTTITTTPHHDDTVAAPPVGGRHDYVASPPPPKPQDEQRQIIITSSSSTLPLQASY
Signal peptide: MISFFRAFFLIIIISFLIFVGAQA
Modification: T9 4-hydroxyproline;T10 4-hydroxyproline;T12 4-hydroxyproline
Glycosylation: T9 O-linked (Ara...) hydroxyproline;T10 O-linked (Ara...) hydroxyproline;T12 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: they are part of the wound signaling of tomato plants that activates defense against herbivores and pathogens
Mechanism: Cause an alkalinization of suspension-cultured cells and induce the synthesis of defensive proteinase inhibitor proteins
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004615_AF2.pdb

hor004615_ESM.pdb

Mass:	185265	Formula:	C69H111N21O23
Absent amino acids:	ACEFIMNQWY	Common amino acids:	P
pI:	7.55	Basic residues:	3
Polar residues:	4	Hydrophobic residues:	2
Hydrophobicity:	-131.33	Boman Index:	-4204
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	45.33
Instability Index:	11566.67	Extinction Coefficient cystines:	0
Absorbance 280nm:	0