General Information

  • ID:  hor004614
  • Uniprot ID:  Q7XAD0
  • Protein name:  HypSys I
  • Gene name:  NA
  • Organism:  Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
  • Family:  Systemin family
  • Source:  Plant
  • Expression:  By wounding and methyl jasmonate in leaves. |Leaves.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Solanum subgen. Lycopersicon (subgenus), Solanum (genus), Solaneae (tribe), Solanoideae (subfamily), Solanaceae (family), Solanales (order), lamiids, asterids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0006952 defense response; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RTPYKTPPPPTSSSPTHQ
  • Length:  18
  • Propeptide:  MISFFRAFFLIIIISFLIFVGAQARTLLGNYHDDEMLIELKLESGNYGRTPYKTPPPPTSSSPTHQEIVNGRHDSVLPPPSPKTDPIIGQLTTITTTPHHDDTVAAPPVGGRHDYVASPPPPKPQDEQRQIIITSSSSTLPLQASY
  • Signal peptide:  MISFFRAFFLIIIISFLIFVGAQA
  • Modification:  T3 4-hydroxyproline;T7 4-hydroxyproline;T8 4-hydroxyproline;T9 4-hydroxyproline;T10 4-hydroxyproline;T15 4-hydroxyproline
  • Glycosylation:  T3 O-linked (Ara...) hydroxyproline;T7 O-linked (Ara...) hydroxyproline;T8 O-linked (Ara...) hydroxyproline;T9 O-linked (Ara...) hydroxyproline;T10 O-linked (Ara...) hydroxyproline;T15 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  they are part of the wound signaling of tomato plants that activates defense against herbivores and pathogens
  • Mechanism:  Cause an alkalinization of suspension-cultured cells and induce the synthesis of defensive proteinase inhibitor proteins
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q7XAD0-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004614_AF2.pdbhor004614_ESM.pdb

Physical Information

Mass: 228254 Formula: C87H135N25O28
Absent amino acids: ACDEFGILMNVW Common amino acids: P
pI: 10.45 Basic residues: 3
Polar residues: 8 Hydrophobic residues: 0
Hydrophobicity: -173.33 Boman Index: -5129
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: 8735.56 Extinction Coefficient cystines: 1490
Absorbance 280nm: 87.65

Literature

  • PubMed ID:  12748180
  • Title:  Systemic Signaling in Tomato Plants for Defense Against Herbivores. Isolation and Characterization of Three Novel Defense-Signaling Glycopeptide Hormones Coded in a Single Precursor Gene