General Information

  • ID:  hor004612
  • Uniprot ID:  Q5FVX5
  • Protein name:  Augurin
  • Gene name:  ecrg4
  • Organism:  Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
  • Family:  Augurin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Silurana (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region; GO:0005737 cytoplasm; GO:0005886 plasma membrane; GO:0016020 membrane; GO:0016324 apical plasma membrane

Sequence Information

  • Sequence:  QLWDRTRPEVQQWYQQFLYMGFDEQKYEDDLSYWMSQGRGGSEYYGGFHQHHYDEDAPIGPR
  • Length:  62
  • Propeptide:  MVLLFLLVIFLCPGSTNGNKLRLMLQKREAGEPSKTIVSVKENKANEFLNSLKRPKRQLWDRTRPEVQQWYQQFLYMGFDEQKYEDDLSYWMSQGRGGSEYYGGFHQHHYDEDAPIGPRNPYTFRHGAGVNYDDY
  • Signal peptide:  MVLLFLLVIFLCPGSTNG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May attenuate cell proliferation and induce senescence in the central nervous system.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q5FVX5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004612_AF2.pdbhor004612_ESM.pdb

Physical Information

Mass: 871243 Formula: C344H472N92O104S2
Absent amino acids: CN Common amino acids: QGY
pI: 4.44 Basic residues: 8
Polar residues: 18 Hydrophobic residues: 12
Hydrophobicity: -139.35 Boman Index: -17091
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 31.45
Instability Index: 7200.48 Extinction Coefficient cystines: 26930
Absorbance 280nm: 441.48

Literature

  • PubMed ID:  NA
  • Title:  NA