General Information

  • ID:  hor004608
  • Uniprot ID:  Q99LS0
  • Protein name:  Augurin
  • Gene name:  Ecrg4
  • Organism:  Mus musculus (Mouse)
  • Family:  Augurin family
  • Source:  animal
  • Expression:  At embryonic stage 14.5 dpc, primarily expressed in the choroid plexus, and low expression in the heart and cartilage (at protein level) . |Expressed in the intermediate lobe of pituitary, glomerular layer of adrenal cortex, choroid plexus and atrioventri
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007417 central nervous system development; GO:0008285 negative regulation of cell population proliferation; GO:0009611 response to wounding; GO:0030103 vasopressin secretion; GO:0031145 anaphase-promoting complex-dependent catabolic process; GO:0042127 regulation of cell population proliferation; GO:0051461 positive regulation of corticotropin secretion; GO:0051466 positive regulation of corticotropin-releasing hormone secretion; GO:0070314 G1 to G0 transition; GO:0090398 cellular senescence; GO:2000854 positive regulation of corticosterone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0005886 plasma membrane; GO:0016020 membrane; GO:0016324 apical plasma membrane; GO:0031045 dense core granule

Sequence Information

  • Sequence:  QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDVNYWLNRNRNGHDYYGDYYQRHYDEDAAIGPH
  • Length:  62
  • Propeptide:  MSTSSARPAVLALAGLALLLLLCLGPDGISGNKLKKMLQKREGPVPSKTNVAVAENTAKEFLGGLKRAKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDVNYWLNRNRNGHDYYGDYYQRHYDEDAAIGPHSRESFRHGASVNYNDY
  • Signal peptide:  MSTSSARPAVLALAGLALLLLLCLGPDGISG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May attenuate cell proliferation and induce senescence of oligodendrocyte and neural precursor cells in the central nervous system. ECRG4-induced senescence is characterized by G1 arrest, RB1 dephosphorylation and accelerated CCND1 and CCND3 proteasomal degradation.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q99LS0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004608_AF2.pdbhor004608_ESM.pdb

Physical Information

Mass: 891362 Formula: C354H483N97O106S
Absent amino acids: CS Common amino acids: DY
pI: 4.47 Basic residues: 9
Polar residues: 17 Hydrophobic residues: 15
Hydrophobicity: -147.74 Boman Index: -19939
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 39.35
Instability Index: 5713.71 Extinction Coefficient cystines: 28420
Absorbance 280nm: 465.9

Literature

  • PubMed ID:  17284679
  • Title:  Identification of novel peptide hormones in the human proteome by hidden Markov model screening.
  • PubMed ID:  20404145
  • Title:  Esophageal cancer-related gene 4 is a secreted inducer of cell senescence expressed by aged CNS precursor cells.