General Information

  • ID:  hor004606
  • Uniprot ID:  Q9H1Z8
  • Protein name:  Augurin
  • Gene name:  ECRG4
  • Organism:  Homo sapiens (Human)
  • Family:  Augurin family
  • Source:  Human
  • Expression:  Expressed in the brain, with expression in the epithelial cell layer of the choroid plexus (at protein level).
  • Disease:  Diseases associated with ECRG4 include Castration-Resistant Prostate Carcinoma and Esophageal Cancer.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005515 protein binding
  • GO BP:  GO:0007417 central nervous system development; GO:0031145 anaphase-promoting complex-dependent catabolic process; GO:0042127 regulation of cell population proliferation; GO:0070314 G1 to G0 transition; GO:0090398 cellular senescence
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0005886 plasma membrane; GO:0016020 membrane; GO:0016324 apical plasma membrane

Sequence Information

  • Sequence:  QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPR
  • Length:  62(71-132)
  • Propeptide:  MAASPARPAVLALTGLALLLLLCWGPGGISGNKLKLMLQKREAPVPTKTKVAVDENKAKEFLGSLKRQKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHGASVNYDDY
  • Signal peptide:  MAASPARPAVLALTGLALLLLLCWGPGGISG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May attenuate cell proliferation and induce senescence of oligodendrocyte and neural precursor cells in the central nervous system. ECRG4-induced senescence is characterized by G1 arrest, RB1 dephosphorylation and accelerated CCND1 and CCND3 proteasomal d
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9H1Z8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004606_AF2.pdbhor004606_ESM.pdb

Physical Information

Mass: 896469 Formula: C356H492N96O108S
Absent amino acids: C Common amino acids: DY
pI: 4.35 Basic residues: 9
Polar residues: 17 Hydrophobic residues: 14
Hydrophobicity: -149.03 Boman Index: -21008
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 39.35
Instability Index: 5582.1 Extinction Coefficient cystines: 28420
Absorbance 280nm: 465.9

Literature

  • PubMed ID:  21349154
  • Title:  Ecrg4 expression and its product augurin in the choroid plexus: impact on fetal brain development, cerebrospinal fluid homeostasis and neuroprogenitor cell response to CNS injury.