General Information

  • ID:  hor004605
  • Uniprot ID:  Q9I980
  • Protein name:  Thymosin beta-10
  • Gene name:  NA
  • Organism:  Torpedo marmorata (Marbled electric ray)
  • Family:  Thymosin beta family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Torpedo (genus), Torpedinidae (family), Torpediniformes (order), Batoidea (superorder), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization
  • GO CC:  GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  ADKPDFGEVASFDKSKLKKTDTEVKNTLPTKETIDQEKKAESS
  • Length:  43(2-44)
  • Propeptide:  MADKPDFGEVASFDKSKLKKTDTEVKNTLPTKETIDQEKKAESS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton.
  • Mechanism:  Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9I980-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004605_AF2.pdbhor004605_ESM.pdb

Physical Information

Mass: 553461 Formula: C207H340N54O75
Absent amino acids: CHMRWY Common amino acids: K
pI: 4.98 Basic residues: 9
Polar residues: 11 Hydrophobic residues: 10
Hydrophobicity: -130 Boman Index: -13106
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 47.67
Instability Index: 1200.7 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA