General Information

  • ID:  hor004593
  • Uniprot ID:  O14604
  • Protein name:  Thymosin beta-4
  • Gene name:  TMSB4Y
  • Organism:  Homo sapiens (Human)
  • Family:  Thymosin beta family
  • Source:  Human
  • Expression:  Ubiquitous.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding; GO:0005515 protein binding
  • GO BP:  GO:0007015 actin filament organization; GO:0008064 regulation of actin polymerization or depolymerization; GO:0030334 regulation of cell migration; GO:0042989 sequestering of actin monomers
  • GO CC:  GO:0005634 nucleus; GO:0005737 cytoplasm; GO:0005829 cytosol; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
  • Length:  44(1-44)
  • Propeptide:  MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton.
  • Mechanism:  Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O14604-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-O14604-F1.pdbhor004593_AF2.pdbhor004593_ESM.pdb

Physical Information

Mass: 577973 Formula: C211H353N59O77S2
Absent amino acids: CHVWY Common amino acids: EK
pI: 5.04 Basic residues: 9
Polar residues: 11 Hydrophobic residues: 7
Hydrophobicity: -154.55 Boman Index: -14635
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 40
Instability Index: 6684.55 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA