General Information

  • ID:  hor004588
  • Uniprot ID:  P34032
  • Protein name:  Hematopoietic system regulatory peptide
  • Gene name:  TMSB4
  • Organism:  Oryctolagus cuniculus (Rabbit)
  • Family:  Thymosin beta family
  • Source:  Animal
  • Expression:  Originally found in thymus but it is widely distributed in many tissues.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization
  • GO CC:  GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  ADKP
  • Length:  4(2-5)
  • Propeptide:  MADKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Signal peptide:  NA
  • Modification:  T1 N-acetylalanine;T3 N6-acetyllysine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits the entry of hematopoietic pluripotent stem cells into the S-phase
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P34032-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004588_AF2.pdbhor004588_ESM.pdb

Physical Information

Mass: 48317 Formula: C18H31N5O7
Absent amino acids: CEFGHILMNQRSTVWY Common amino acids: ADKP
pI: 6.34 Basic residues: 1
Polar residues: 0 Hydrophobic residues: 1
Hydrophobicity: -180 Boman Index: -1246
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 25
Instability Index: -5380 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  6838210
  • Title:  Distribution of thymosin beta 4 in vertebrate classes.