General Information

  • ID:  hor004582
  • Uniprot ID:  P0CG34
  • Protein name:  Thymosin beta-15A
  • Gene name:  TMSB15A
  • Organism:  Homo sapiens (Human)
  • Family:  Thymosin beta family
  • Source:  Human
  • Expression:  Down-regulated by TGFB1. |Neuroblastoma-specific.
  • Disease:  Diseases associated with TMSB15A include Focal Segmental Glomerulosclerosis 1 and Ankyloglossia With Or Without Tooth Anomalies.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization; GO:0030334 regulation of cell migration; GO:0042989 sequestering of actin monomers
  • GO CC:  GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS
  • Length:  44(2-45)
  • Propeptide:  MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton.
  • Mechanism:  Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0CG34-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004582_AF2.pdbhor004582_ESM.pdb

Physical Information

Mass: 586477 Formula: C215H360N60O80S
Absent amino acids: AGHMWY Common amino acids: K
pI: 5.02 Basic residues: 9
Polar residues: 13 Hydrophobic residues: 7
Hydrophobicity: -157.5 Boman Index: -16088
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 48.64
Instability Index: 4630.45 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12665801
  • Title:  Exploring Proteomes and Analyzing Protein Processing by Mass Spectrometric Identification of Sorted N-terminal Peptides