General Information

  • ID:  hor004570
  • Uniprot ID:  Q95JC9
  • Protein name:  Proline-rich peptide SP-A
  • Gene name:  NA
  • Organism:  Sus scrofa (Pig)
  • Family:  NA
  • Source:  Animal
  • Expression:  Acinar cells and secretory granules of the parotid gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RSPFFDLEDANSNSAEKFLRPPPGGGPPRPPPPEESQGEGHQKRPRPPGDGPEQGP
  • Length:  56(17-72)
  • Propeptide:  MLPILLSVALLALSSARSPFFDLEDANSNSAEKFLRPPPGGGPPRPPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPLG
  • Signal peptide:  MLPILLSVALLALSSA
  • Modification:  T12 Phosphoserine;T14 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The parotid hormone stimulates dentinal fluid transport in teeth.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q95JC9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004570_AF2.pdbhor004570_ESM.pdb

Physical Information

Mass: 697762 Formula: C261H394N80O84
Absent amino acids: CIMTVWY Common amino acids: P
pI: 4.95 Basic residues: 8
Polar residues: 14 Hydrophobic residues: 7
Hydrophobicity: -166.61 Boman Index: -17096
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 17.5
Instability Index: 10408.21 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16112392
  • Title:  Two proline-rich peptides from pig (Sus scrofa) salivary glands generated by pre-secretory pathway underlying the action of a proteinase cleaving ProAla bonds.