General Information

  • ID:  hor004568
  • Uniprot ID:  Q9XZE6
  • Protein name:  Eclosion hormone
  • Gene name:  NA
  • Organism:  Romalea microptera (Eastern lubber grasshopper) (Romalea guttata)
  • Family:  Insect eclosion hormone family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Romalea (genus), Romaleinae (subfamily), Romaleidae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008255 ecdysis-triggering hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0018990 ecdysis, chitin-based cuticle
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CKKMVGAYFEGELCADACLKFKGKMCPTARTSPPSRPSSTSLSSRCCSIKSLCKA
  • Length:  55
  • Propeptide:  CKKMVGAYFEGELCADACLKFKGKMCPTARTSPPSRPSSTSLSSRCCSIKSLCKA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptide that triggers the performance of ecdysis behaviors at the end of a molt. It triggers adult behavior patterns: larval, pupal and adult ecdysis, and plasticization during the molt.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9XZE6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q9XZE6-F1.pdbhor004568_AF2.pdbhor004568_ESM.pdb

Physical Information

Mass: 682932 Formula: C247H413N71O75S9
Absent amino acids: HNQW Common amino acids: S
pI: 9.23 Basic residues: 10
Polar residues: 23 Hydrophobic residues: 13
Hydrophobicity: -17.64 Boman Index: -8427
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 49.82
Instability Index: 5776 Extinction Coefficient cystines: 1865
Absorbance 280nm: 34.54

Literature

  • PubMed ID:  NA
  • Title:  NA