General Information

  • ID:  hor004567
  • Uniprot ID:  P25331
  • Protein name:  Eclosion hormone
  • Gene name:  NA
  • Organism:  Bombyx mori (Silk moth)
  • Family:  Insect eclosion hormone family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bombyx (genus), Bombycinae (subfamily), Bombycidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008255 ecdysis-triggering hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0018990 ecdysis, chitin-based cuticle
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SPAIASSYDAMEICIENCAQCKKMFGPWFEGSLCAESCIKARGKDIPECESFASISPFLNKL
  • Length:  62
  • Propeptide:  MANKLTAVIVVALAVAFMVNLDYANCSPAIASSYDAMEICIENCAQCKKMFGPWFEGSLCAESCIKARGKDIPECESFASISPFLNKL
  • Signal peptide:  MANKLTAVIVVALAVAFMVNLDYANC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptide that triggers the performance of ecdysis behaviors at the end of a molt. It triggers adult behavior patterns: larval, pupal and adult ecdysis, and plasticization during the molt.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  14-38; 18-34; 21-49
  • Structure ID:  AF-P25331-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004567_AF2.pdbhor004567_ESM.pdb

Physical Information

Mass: 785607 Formula: C296H460N74O91S8
Absent amino acids: HTV Common amino acids: SA
pI: 4.56 Basic residues: 6
Polar residues: 20 Hydrophobic residues: 21
Hydrophobicity: 3.71 Boman Index: -6073
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 67.9
Instability Index: 6969.68 Extinction Coefficient cystines: 7365
Absorbance 280nm: 120.74

Literature

  • PubMed ID:  NA
  • Title:  Amino acid sequence of eclosion hormone of the silkworm, Bombyx mori.