General Information

  • ID:  hor004566
  • Uniprot ID:  P11919
  • Protein name:  Eclosion hormone
  • Gene name:  NA
  • Organism:  Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • Family:  Insect eclosion hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Manduca (genus), Sphingini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008255 ecdysis-triggering hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0018990 ecdysis, chitin-based cuticle
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NPAIATGYDPMEICIENCAQCKKMLGAWFEGPLCAESCIKFKGKLIPECEDFASIAPFLNKL
  • Length:  62(27-88)
  • Propeptide:  MAGKVTVAFFMFAMIAFLANFGYVECNPAIATGYDPMEICIENCAQCKKMLGAWFEGPLCAESCIKFKGKLIPECEDFASIAPFLNKL
  • Signal peptide:  MAGKVTVAFFMFAMIAFLANFGYVEC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptide that triggers the performance of ecdysis behaviors at the end of a molt. It triggers adult behavior patterns: larval, pupal and adult ecdysis, and plasticization during the molt.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  14-38; 18-34; 21-49
  • Structure ID:  AF-P11919-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004566_AF2.pdbhor004566_ESM.pdb

Physical Information

Mass: 790132 Formula: C305H475N73O87S8
Absent amino acids: HRV Common amino acids: ACEIK
pI: 4.56 Basic residues: 6
Polar residues: 17 Hydrophobic residues: 23
Hydrophobicity: 14.68 Boman Index: -2939
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 80.48
Instability Index: 4518.87 Extinction Coefficient cystines: 7365
Absorbance 280nm: 120.74

Literature

  • PubMed ID:  3304284
  • Title:  Isolation and primary structure of the eclosion hormone of the tobacco hornworm, Manduca sexta.
  • PubMed ID:  3609300
  • Title:   Microanalysis of the amino acid sequence of the eclosion hormone from the tobacco hornworm Manduca sexta.