General Information

  • ID:  hor004564
  • Uniprot ID:  P0DM26
  • Protein name:  Conorfamide-Tx1
  • Gene name:  NA
  • Organism:  Conus textile (Cloth-of-gold cone)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed by the venom duct.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cylinder (subgenus), Conus (genus), Conidae (family), Conoidea (superfamily), Neogastropoda (order), Caenogastropoda (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PGVLDIPVKSNSDDDSIFRY
  • Length:  20(27-46)
  • Propeptide:  MSGRGFLLLALLLLVTVEATKVEKNKPGVLDIPVKSNSDDDSIFRYGRRDMQSPLLSERLRF
  • Signal peptide:  MSGRGFLLLALLLLVTVEA
  • Modification:  T20 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide does not show activity on human and mouse sensory neuron-specific G-protein coupled receptors MRGPRX1.
  • Mechanism:  Negative results: the mature peptide does not contain cysteine residue.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0DM26-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004564_AF2.pdbhor004564_ESM.pdb

Physical Information

Mass: 257653 Formula: C99H153N25O34
Absent amino acids: ACEHMQTW Common amino acids: D
pI: 4.02 Basic residues: 2
Polar residues: 6 Hydrophobic residues: 6
Hydrophobicity: -46 Boman Index: -4557
Half-Life / Aliphatic Index: >20 hour Aliphatic Index: 87.5
Instability Index: 2166 Extinction Coefficient cystines: 1490
Absorbance 280nm: 78.42

Literature

  • PubMed ID:  30243794
  • Title:  Conopeptides promote itch through human itch receptor hMgprX1.