General Information

  • ID:  hor004558
  • Uniprot ID:  E1ZZF9
  • Protein name:  FMRFamide 2
  • Gene name:  EAG_11727
  • Organism:  Camponotus floridanus (Florida carpenter ant)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed throughout the central nervous system.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Camponotus (genus), Camponotini (tribe), Formicinae (subfamily), Formicidae (family), Formicoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  WKSPDIVIRF
  • Length:  10(85-94)
  • Propeptide:  MLVSSSVLKDDSSLRIFKESPNEFEYIIKRHDMDDRKEDTESKERRSTMGSSFIRFGRGQSFFNNLDNSAFDNEIDSKVSRHPRWKSPDIVIRFGRSGMKSTNDEQPKRGKNDLNFIRFGRNIQIVPTDFDLSAVCSALMSNDAISDAGLHPDVTRLFRLCNNLNKITGEISLDSLETNSNHRE
  • Signal peptide:  NA
  • Modification:  T10 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Have modulatory actions at skeletal neuromuscular junctions
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-E1ZZF9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004558_AF2.pdbhor004558_ESM.pdb

Physical Information

Mass: 142121 Formula: C61H93N15O14
Absent amino acids: ACEGHLMNQTY Common amino acids: I
pI: 9.69 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 5
Hydrophobicity: 8 Boman Index: -1340
Half-Life: 2.8 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 107
Instability Index: 3691 Extinction Coefficient cystines: 5500
Absorbance 280nm: 611.11

Literature

  • PubMed ID:  25641051
  • Title:  Neuropeptidomics of the carpenter ant Camponotus floridanus.