General Information

  • ID:  hor004551
  • Uniprot ID:  P0DOZ7
  • Protein name:  Conorfamide-Vc1
  • Gene name:  NA
  • Organism:  Conus victoriae (Queen Victoria cone)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed by the venom duct.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cylinder (subgenus), Conus (genus), Conidae (family), Conoidea (superfamily), Neogastropoda (order), Caenogastropoda (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSGFLLAWSGPRNRFVRF
  • Length:  18(26-43)
  • Propeptide:  MSGRGFLLLALLLLVTVEATKVEKKHSGFLLAWSGPRNRFVRFGRRDMQSPLLSERLRL
  • Signal peptide:  MSGRGFLLLALLLLVTVEA
  • Modification:  T18 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  1-14Missing: Complete loss of activating potency on MrgprX1 receptor.; 1-6Missing: Complete loss of activating potency on MrgprX1 receptor.

Activity

  • Function:  This peptide activates human and mouse sensory neuron-specific G-protein coupled receptors MRGPRX1 (PubMed:30243794). The activity on human receptors has been measured (EC(50)=1.8 uM) (PubMed:30243794). Compared with the agonist chloroquine (anti-malaria
  • Mechanism:  The mature peptide does not contain cysteine residue.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  1.8*10(-6)M
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0DOZ7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004551_AF2.pdbhor004551_ESM.pdb

Physical Information

Mass: 245086 Formula: C101H147N31O22
Absent amino acids: CDEIKMQTY Common amino acids: FR
pI: 12.8 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 8
Hydrophobicity: -17.22 Boman Index: -3402
Half-Life / Aliphatic Index: 3.5 hour Aliphatic Index: 65
Instability Index: 1211.11 Extinction Coefficient cystines: 5500
Absorbance 280nm: 323.53

Literature

  • PubMed ID:  25464369
  • Title:  Discovery by Proteogenomics and Characterization of an RF-amide Neuropeptide From Cone Snail Venom