General Information

  • ID:  hor004539
  • Uniprot ID:  P60041
  • Protein name:  Somatostatin-28
  • Gene name:  SST
  • Organism:  Mus musculus (Mouse)
  • Family:  Somatostatin family
  • Source:  Animal
  • Expression:  In the pancreas, somatostatin is expressed in delta cells of the islets of Langerhans. In the stomach, it is expressed in parietal cells of oxyntic mucosa and in the small intestine, it is found in the villus (at protein level) .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0042802 identical protein binding; GO:0048018 receptor ligand activity
  • GO BP:  GO:0006972 hyperosmotic response; GO:0009410 response to xenobiotic stimulus; GO:0010243 response to organonitrogen compound; GO:0010447 response to acidic pH; GO:0030334 regulation of cell migration; GO:0038170 somatostatin signaling pathway; GO:0043200 response to amino acid; GO:0048545 response to steroid hormone; GO:0099072 regulation of postsynaptic membrane neurotransmitter receptor levels
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0043025 neuronal cell body; GO:0098982 GABA-ergic synapse; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  SANSNPAMAPRERKAGCKNFFWKTFTSC
  • Length:  28(89-116)
  • Propeptide:  MLSCRLQCALAALCIVLALGGVTGAPSDPRLRQFLQKSLAAATGKQELAKYFLAELLSEPNQTENDALEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
  • Signal peptide:  MLSCRLQCALAALCIVLALGGVTG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition of ghrelin-stimulated secreti
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Sstr2, Sstr1
  • Target Unid:   P30875, P30873
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  175 seconds ( PubMed ID: 6127205 )

Structure

  • Disulfide bond:  17-28
  • Structure ID:  AF-P60041-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004539_AF2.pdbhor004539_ESM.pdb

Physical Information

Mass: 363235 Formula: C137H209N41O39S3
Absent amino acids: DHILQVY Common amino acids: A
pI: 10.51 Basic residues: 5
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: -73.21 Boman Index: -6420
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 14.29
Instability Index: 3444.64 Extinction Coefficient cystines: 5625
Absorbance 280nm: 208.33

Literature

  • PubMed ID:  6127205
  • Title:  NA