General Information

  • ID:  hor004532
  • Uniprot ID:  P61278
  • Protein name:  Neuronostatin
  • Gene name:  SST
  • Organism:  Homo sapiens (Human)
  • Family:  Somatostatin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with SST include Somatostatinoma and Acromegaly.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding; GO:0048018 receptor ligand activity
  • GO BP:  GO:0006972 hyperosmotic response; GO:0007166 cell surface receptor signaling pathway; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007267 cell-cell signaling; GO:0007268 chemical synaptic transmission; GO:0007584 response to nutrient; GO:0007586 digestion; GO:0008285 negative regulation of cell population proliferation; GO:0008628 hormone-mediated apoptotic signaling pathway; GO:0009410 response to xenobiotic stimulus; GO:0010243 response to organonitrogen compound; GO:0010447 response to acidic pH; GO:0030334 regulation of cell migration; GO:0038170 somatostatin signaling pathway; GO:0043200 response to amino acid; GO:0048545 response to steroid hormone; GO:0099072 regulation of postsynaptic membrane neurotransmitter receptor levels
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0043025 neuronal cell body; GO:0098982 GABA-ergic synapse; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  LRQFLQKSLAAAA
  • Length:  13(31-43)
  • Propeptide:  MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
  • Signal peptide:  MLSCRLQCALAALSIVLALGCVTG
  • Modification:  T13 Alanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May enhance low-glucose-induced glucagon release by pancreatic alpha cells. This effect may be mediated by binding to GPR107 and PKA activation. May regulate cardiac contractile function. May compromise cardiomyocyte viability. In the central nervous syst
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  SSTR5, SSTR2
  • Target Unid:   P35346, P30874
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P61278-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004532_AF2.pdbhor004532_ESM.pdb

Physical Information

Mass: 163093 Formula: C64H109N19O17
Absent amino acids: CDEGHIMNPTVWY Common amino acids: A
pI: 11.65 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 8
Hydrophobicity: 40 Boman Index: -997
Half-Life / Aliphatic Index: 5.5 hour Aliphatic Index: 120.77
Instability Index: 5813.85 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  29615476
  • Title:  Neuronostatin Exerts Actions on Pituitary That Are Unique From Its Sibling Peptide Somatostatin.
  • PubMed ID:  25012062
  • Title:  Neuronostatin Attenuates Myocardial Contractile Function Through Inhibition of Sarcoplasmic Reticulum Ca2+-ATPase in Murine Heart.
  • PubMed ID:  26561648
  • Title:  Neuronostatin Acts via GP