General Information

  • ID:  hor004530
  • Uniprot ID:  P26917
  • Protein name:  Somatostatin-28
  • Gene name:  SST
  • Organism:  Bos taurus (Bovine)
  • Family:  Somatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0030334 regulation of cell migration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SANSNPAMAPRERKAGCKNFFWKTFTSC
  • Length:  28(89-116)
  • Propeptide:  MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTEIDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
  • Signal peptide:  MLSCRLQCALAALSIVLALGGVTG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Somatostatin-14]: Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition of ghrelin
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  SSTR2, SSTR1
  • Target Unid:   P34993, E1BFV6
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  173 seconds ( PubMed ID: 6127205 )

Structure

  • Disulfide bond:  17-28
  • Structure ID:  AF-P26917-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004530_AF2.pdbhor004530_ESM.pdb

Physical Information

Mass: 363235 Formula: C137H209N41O39S3
Absent amino acids: DHILQVY Common amino acids: A
pI: 10.51 Basic residues: 5
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: -73.21 Boman Index: -6420
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 14.29
Instability Index: 3444.64 Extinction Coefficient cystines: 5625
Absorbance 280nm: 208.33

Literature

  • PubMed ID:  6127205
  • Title:  NA