General Information

  • ID:  hor004523
  • Uniprot ID:  O46688
  • Protein name:  Somatostatin-14
  • Gene name:  SST
  • Organism:  Ovis aries (Sheep)
  • Family:  Somatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0048018 receptor ligand activity
  • GO BP:  GO:0030334 regulation of cell migration; GO:0038170 somatostatin signaling pathway; GO:0099072 regulation of postsynaptic membrane neurotransmitter receptor levels
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0098982 GABA-ergic synapse

Sequence Information

  • Sequence:  AGCKNFFWKTFTSC
  • Length:  14(103-116)
  • Propeptide:  MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
  • Signal peptide:  MLSCRLQCALAALSIVLALGGVTG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition of ghrelin-stimulated secreti
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  SSTR1, SSTR2
  • Target Unid:  W5Q7Z2, W5NPT8
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 70 seconds ( PubMed ID: 6117506 )

Structure

  • Disulfide bond:  45730
  • Structure ID:  AF-O46688-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004523_AF2.pdbhor004523_ESM.pdb

Physical Information

Mass: 187196 Formula: C76H106N18O19S2
Absent amino acids: DEHILMPQRVY Common amino acids: F
pI: 8.82 Basic residues: 2
Polar residues: 7 Hydrophobic residues: 5
Hydrophobicity: 2.86 Boman Index: -970
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 7.14
Instability Index: 3065 Extinction Coefficient cystines: 5625
Absorbance 280nm: 432.69

Literature

  • PubMed ID:  6117506
  • Title:  NA