General Information

  • ID:  hor004511
  • Uniprot ID:  Q9PRR0
  • Protein name:  Somatostatin-35
  • Gene name:  SST
  • Organism:  Lampetra fluviatilis (European river lamprey) (Petromyzon fluviatilis)
  • Family:  Somatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lampetra (genus), Petromyzontidae (family), Petromyzontiformes (order), Hyperoartia (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AAAAPGAAGGAQLPLGNRERKAGCKNFFWKTFSSC
  • Length:  35(1-35)
  • Propeptide:  AAAAPGAAGGAQLPLGNRERKAGCKNFFWKTFSSC
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibit the release of somatotropin
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  24-35
  • Structure ID:  AF-Q9PRR0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q9PRR0-F1.pdbhor004511_AF2.pdbhor004511_ESM.pdb

Physical Information

Mass: 419074 Formula: C158H244N48O44S2
Absent amino acids: DHIMVY Common amino acids: A
pI: 10.51 Basic residues: 5
Polar residues: 12 Hydrophobic residues: 14
Hydrophobicity: -22 Boman Index: -3864
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 45.14
Instability Index: 3101.71 Extinction Coefficient cystines: 5625
Absorbance 280nm: 165.44

Literature

  • PubMed ID:  8575665
  • Title:  Characterization of insulin, glucagon, and somatostatin from the river lamprey, Lampetra fluviatilis.