General Information

  • ID:  hor004508
  • Uniprot ID:  A0A3B3INN6
  • Protein name:  Somatostatin-2
  • Gene name:  LOC110017086
  • Organism:  Oryzias latipes (Japanese rice fish) (Japanese killifish)
  • Family:  Somatostatin family
  • Source:  Animal
  • Expression:  Brain
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryzias (genus), Oryziinae (subfamily), Adrianichthyidae (family), Adrianichthyoidei (suborder), Beloniformes (order), Atherinomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AGCRNFFWKTFTSC
  • Length:  14(62-75)
  • Propeptide:  MLGSQVQMLLADPTRLLLMKLVLELVALRRQEMLQELEEEELGGRERLMKRHIRFTQRERKAGCRNFFWKTFTSC
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in modulating medaka behaviors
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 62 seconds ( PubMed ID: 6117506 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A3B3INN6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004508_AF2.pdbhor004508_ESM.pdb

Physical Information

Mass: 189997 Formula: C76H106N20O19S2
Absent amino acids: DEHILMPQVY Common amino acids: F
pI: 8.83 Basic residues: 2
Polar residues: 7 Hydrophobic residues: 5
Hydrophobicity: -1.43 Boman Index: -1907
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 7.14
Instability Index: 3946.43 Extinction Coefficient cystines: 5625
Absorbance 280nm: 432.69

Literature

  • PubMed ID:  19118555##6117506
  • Title:  Mass Spectrometric Map of Neuropeptide Expression and Analysis of the Gamma-Prepro-Tachykinin Gene Expression in the Medaka (Oryzias Latipes) Brain