General Information

  • ID:  hor004507
  • Uniprot ID:  A0A3B3IDD3
  • Protein name:  Somatostatin-1
  • Gene name:  LOC101157910
  • Organism:  Oryzias latipes (Japanese rice fish) (Japanese killifish)
  • Family:  Somatostatin family
  • Source:  Animal
  • Expression:  Brain
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryzias (genus), Oryziinae (subfamily), Adrianichthyidae (family), Adrianichthyoidei (suborder), Beloniformes (order), Atherinomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0030334 regulation of cell migration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  AGCKNFFWKTFTSC
  • Length:  14(104-117)
  • Propeptide:  MMSSSSRLLLLLLSLTASISCSSAAQRDSKLRLLLQRTPLLGSKQDMSRSSLAELLLSDLLQMENEVLEEDGFPLSDGEPEDVRVDLERAAASGPLLAPRDRKAGCKNFFWKTFTSC
  • Signal peptide:  MMSSSSRLLLLLLSLTASISCSSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in modulating medaka behaviors
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  61 seconds ( PubMed ID: 6117506 )

Structure

  • Disulfide bond:  45730
  • Structure ID:  AF-A0A3B3IDD3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004507_AF2.pdbhor004507_ESM.pdb

Physical Information

Mass: 187196 Formula: C76H106N18O19S2
Absent amino acids: DEHILMPQRVY Common amino acids: F
pI: 8.82 Basic residues: 2
Polar residues: 7 Hydrophobic residues: 5
Hydrophobicity: 2.86 Boman Index: -970
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 7.14
Instability Index: 3065 Extinction Coefficient cystines: 5625
Absorbance 280nm: 432.69

Literature

  • PubMed ID:  19118555##6117506
  • Title:  Mass Spectrometric Map of Neuropeptide Expression and Analysis of the Gamma-Prepro-Tachykinin Gene Expression in the Medaka (Oryzias Latipes) Brain