General Information

  • ID:  hor004433
  • Uniprot ID:  P41540
  • Protein name:  Neuropeptide gamma
  • Gene name:  Tac1
  • Organism:  Oryctolagus cuniculus (Rabbit)
  • Family:  Tachykinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007217 tachykinin receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  DAGHGQISHKRHKTDSFVGLM
  • Length:  21(72-92)
  • Propeptide:  MKILVALAVLALVSTQLFAEDIRANDDLNYWSDWSDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDAGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRRK
  • Signal peptide:  MKILVALAVLALVSTQLFA
  • Modification:  T21 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  2mce(PDB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    2mce.pdbhor004433_AF2.pdbhor004433_ESM.pdb

Physical Information

Mass: 267853 Formula: C99H157N33O30S
Absent amino acids: CENPWY Common amino acids: GH
pI: 9.54 Basic residues: 6
Polar residues: 6 Hydrophobic residues: 5
Hydrophobicity: -80.48 Boman Index: -4851
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 55.71
Instability Index: 5696.19 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  Gamma-neuropeptide K: a peptide isolated from rabbit gut that is derived from gamma-preprotachykinin.