General Information

  • ID:  hor004431
  • Uniprot ID:  P41540
  • Protein name:  C-terminal-flanking peptide
  • Gene name:  Tac1
  • Organism:  Oryctolagus cuniculus (Rabbit)
  • Family:  Tachykinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007217 tachykinin receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  ALNSVAYERSAMQNYE
  • Length:  16(96-111)
  • Propeptide:  MKILVALAVLALVSTQLFAEDIRANDDLNYWSDWSDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDAGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRRK
  • Signal peptide:  MKILVALAVLALVSTQLFA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P41540-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004431_AF2.pdbhor004431_ESM.pdb

Physical Information

Mass: 211373 Formula: C78H120N22O28S
Absent amino acids: CDFGHIKPTW Common amino acids: A
pI: 4.26 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 5
Hydrophobicity: -68.13 Boman Index: -3770
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 61.25
Instability Index: 2213.75 Extinction Coefficient cystines: 2980
Absorbance 280nm: 198.67

Literature

  • PubMed ID:  8363593
  • Title:  Nucleotide Sequence of the Rabbit Gamma-Preprotachykinin I cDNA