HORDB

ID: hor004413
Uniprot ID: P55099
Protein name: Neurokinin-B
Gene name: Tac3
Organism: Mus musculus (Mouse)
Family: Tachykinin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0031836 neuromedin K receptor binding; GO:0031837 substance K receptor binding
GO BP: GO:0007217 tachykinin receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0045777 positive regulation of blood pressure; GO:1902093 positive regulation of flagellated sperm motility
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: DMHDFFVGLM
Length: 10(82-91)
Propeptide: MRSAMLFAAVLALSLAWTFGAVCEEPQGQGGRLSKDSDLYQLPPSLLRRLYDSRPVSLEGLLKVLSKASVGPKETSLPQKRDMHDFFVGLMGKRNSQPDTPTDVVEENTPSFGILK
Signal peptide: MRSAMLFAAVLALSLAWTFG
Modification: T10 Methionine amide
Glycosylation: NA
Mutagenesis: NA

Function: Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Is a critical central regulator of gonadal function (By similarity).
Mechanism: NA
Cross BBB: NA
Target: Tacr3, Tacr2
Target Unid: P47937, P30549
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004413_AF2.pdb

hor004413_ESM.pdb

Mass:	137214	Formula:	C55H78N12O15S2
Absent amino acids:	ACEIKNPQRSTWY	Common amino acids:	DFM
pI:	4.11	Basic residues:	1
Polar residues:	1	Hydrophobic residues:	4
Hydrophobicity:	68	Boman Index:	-154
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	68
Instability Index:	5025	Extinction Coefficient cystines:	0
Absorbance 280nm:	0