General Information

  • ID:  hor004411
  • Uniprot ID:  P41539
  • Protein name:  Neuropeptide K
  • Gene name:  Tac1
  • Organism:  Mus musculus (Mouse)
  • Family:  Tachykinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005515 protein binding; GO:0031835 substance P receptor binding; GO:0031836 neuromedin K receptor binding; GO:0031837 substance K receptor binding; GO:0048018 receptor ligand activity
  • GO BP:  GO:0001878 response to yeast; GO:0002675 positive regulation of acute inflammatory response; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0006954 inflammatory response; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007217 tachykinin receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007616 long-term memory; GO:0008217 regulation of blood pressure; GO:0008306 associative learning; GO:0009725 response to hormone; GO:0010459 negative regulation of heart rate; GO:0010634 positive regulation of epithelial cell migration; GO:0019233 sensory perception of pain; GO:0019731 antibacterial humoral response; GO:0019732 antifungal humoral response; GO:0031640 killing of cells of another organism; GO:0032224 positive regulation of synaptic transmission, cholinergic; GO:0032230 positive regulation of synaptic transmission, GABAergic; GO:0045087 innate immune response; GO:0045760 positive regulation of action potential; GO:0045778 positive regulation of ossification; GO:0048265 response to pain; GO:0050671 positive regulation of lymphocyte proliferation; GO:0050829 defense response to Gram-negative bacterium; GO:0050830 defense response to Gram-positive bacterium; GO:0050965 detection of temperature stimulus involved in sensory perception of pain; GO:0051496 positive regulation of stress fiber assembly; GO:0051930 regulation of sensory perception of pain; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:1902093 positive regulation of flagellated sperm motility; GO:1904058 positive regulation of sensory perception of pain; GO:1990090 cellular response to nerve growth factor stimulus; GO:2000854 positive regulation of corticosterone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030424 axon; GO:0043025 neuronal cell body; GO:0045202 synapse

Sequence Information

  • Sequence:  DADSSVEKQVALLKALYGHGQISHKRHKTDSFVGLM
  • Length:  36(72-107)
  • Propeptide:  MKILVAVAVFFLVSTQLFAEEIDANDDLNYWSDWSDSDQIKEAMPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSVEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRRK
  • Signal peptide:  MKILVAVAVFFLVSTQLFA
  • Modification:  T36 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Tacr1, Tacr2
  • Target Unid:   P30548, P30549
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P41539-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004411_AF2.pdbhor004411_ESM.pdb

Physical Information

Mass: 459201 Formula: C174H281N51O53S
Absent amino acids: CNPW Common amino acids: KLS
pI: 9.2 Basic residues: 8
Polar residues: 9 Hydrophobic residues: 12
Hydrophobicity: -40.83 Boman Index: -6116
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 86.67
Instability Index: 4550.28 Extinction Coefficient cystines: 1490
Absorbance 280nm: 42.57

Literature

  • PubMed ID:  NA
  • Title:  NA