General Information

  • ID:  hor004395
  • Uniprot ID:  Q9UHF0
  • Protein name:  Neurokinin-B
  • Gene name:  TAC3
  • Organism:  Homo sapiens (Human)
  • Family:  Tachykinin family
  • Source:  Human
  • Expression:  In pregnancy, the expression of NKB is confined to the outer syncytiotrophoblast of the placenta, significant concentrations of NKB can be detected in plasma as early as week 9, and plasma concentrations of NKB are grossly elevated in pregnancy-induced hy
  • Disease:  Diseases associated with TAC3 include Hypogonadotropic Hypogonadism 10 With Or Without Anosmia and Infertility.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005515 protein binding
  • GO BP:  GO:0007217 tachykinin receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007565 female pregnancy; GO:0045777 positive regulation of blood pressure
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DMHDFFVGLM
  • Length:  10(81-90)
  • Propeptide:  MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE
  • Signal peptide:  MRIMLLFTAILAFSLA
  • Modification:  T10 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Is a critical central regulator of gonadal function.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  TACR3
  • Target Unid:  P29371
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  1p9f(PDB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    1p9f.pdbhor004395_AF2.pdbhor004395_ESM.pdb

Physical Information

Mass: 137214 Formula: C55H78N12O15S2
Absent amino acids: ACEIKNPQRSTWY Common amino acids: DFM
pI: 4.11 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: 68 Boman Index: -154
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 68
Instability Index: 5025 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA