General Information

  • ID:  hor004372
  • Uniprot ID:  P25421
  • Protein name:  Neurokinin A
  • Gene name:  NA
  • Organism:  Carassius auratus (Goldfish)
  • Family:  Tachykinin family
  • Source:  Animal
  • Expression:  Expression is induced in the hypothalamus and olfactory bulb after feeding. |Expressed in the brain throughout development, with expression first observable in the nascent diencephalon, olfactory bulbs and hypothalamus shortly after fertilization. |Expres
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carassius (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007217 tachykinin receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  HKINSFVGLM
  • Length:  10(82-91)
  • Propeptide:  MKFLLPSIVIFLVLCQVFGEELGPKEDLDYWTGSNQVQDEWLQADPFREIIRRMTRKPRPHQFIGLMGKRSPANAQITRKRHKINSFVGLMGKRSQEEPESYEWGTVQIYDKRR
  • Signal peptide:  MKFLLPSIVIFLVLCQVFG
  • Modification:  T10 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P25421-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004372_AF2.pdbhor004372_ESM.pdb

Physical Information

Mass: 130610 Formula: C52H84N14O13S
Absent amino acids: ACDEPQRTWY Common amino acids: FGHIKLMNSV
pI: 9.7 Basic residues: 2
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: 54 Boman Index: -10
Half-Life / Aliphatic Index: 3.5 hour Aliphatic Index: 107
Instability Index: 1480 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA