General Information

  • ID:  hor004371
  • Uniprot ID:  P25421
  • Protein name:  C-terminal-flanking peptide
  • Gene name:  NA
  • Organism:  Carassius auratus (Goldfish)
  • Family:  Tachykinin family
  • Source:  Animal
  • Expression:  Expression is induced in the hypothalamus and olfactory bulb after feeding. |Expressed in the brain throughout development, with expression first observable in the nascent diencephalon, olfactory bulbs and hypothalamus shortly after fertilization. |Expres
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carassius (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007217 tachykinin receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  GKRSQEEPESYEWGTVQIYDKRR
  • Length:  23(92-114)
  • Propeptide:  MKFLLPSIVIFLVLCQVFGEELGPKEDLDYWTGSNQVQDEWLQADPFREIIRRMTRKPRPHQFIGLMGKRSPANAQITRKRHKINSFVGLMGKRSQEEPESYEWGTVQIYDKRR
  • Signal peptide:  MKFLLPSIVIFLVLCQVFG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P25421-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004371_AF2.pdbhor004371_ESM.pdb

Physical Information

Mass: 323464 Formula: C123H189N37O41
Absent amino acids: ACFHLMN Common amino acids: E
pI: 6.68 Basic residues: 5
Polar residues: 7 Hydrophobic residues: 3
Hydrophobicity: -196.96 Boman Index: -9938
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 29.57
Instability Index: 12204.78 Extinction Coefficient cystines: 8480
Absorbance 280nm: 385.45

Literature

  • PubMed ID:  NA
  • Title:  NA