General Information

  • ID:  hor004303
  • Uniprot ID:  E9G1N8
  • Protein name:  Tachykinin-related peptide 3
  • Gene name:  NA
  • Organism:  Daphnia pulex (Water flea)
  • Family:  Tachykinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Daphnia (genus), Daphniidae (family), Anomopoda (infraorder), Cladocera (suborder), Diplostraca (order), Phyllopoda (subclass), Branchiopoda (class), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  APSSNSFMGMR
  • Length:  11(193-203)
  • Propeptide:  MAVLMTVLAYCQPASAAATAVTDDDELMARQTRGLVLRSWRNAQQQTDHSADKTPSAKVAEPILPSQKEAMVFNGLPISMRLVLLQHLAGYDKRTPNSRAFLGMRGKKSSPPGADALTMEDNQLDDASGWPQGDILPDTYYFGPAPQKKKMHGEKFLGMRGKKMMNGLADGTAFIPNWRERYIYQEPFEKKRAPSSNSFMGMRGKRSESTTPTPNDYQFFNDDIIVDEELPDVDSKVSPRRSQERTPI
  • Signal peptide:  MAVLMTVLAYCQPASA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-E9G1N8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004303_AF2.pdbhor004303_ESM.pdb

Physical Information

Mass: 136288 Formula: C48H77N15O16S2
Absent amino acids: CDEHIKLQTVWY Common amino acids: S
pI: 10.55 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: -36.36 Boman Index: -2133
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 9.09
Instability Index: 5394.55 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21830762
  • Title:  Genomics, Transcriptomics, and Peptidomics of Daphnia Pulex Neuropeptides and Protein Hormones