General Information

  • ID:  hor004302
  • Uniprot ID:  E9G1N8
  • Protein name:  Tachykinin-related peptide 2
  • Gene name:  NA
  • Organism:  Daphnia pulex (Water flea)
  • Family:  Tachykinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Daphnia (genus), Daphniidae (family), Anomopoda (infraorder), Cladocera (suborder), Diplostraca (order), Phyllopoda (subclass), Branchiopoda (class), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  KMHGEKFLGMR
  • Length:  11(150-160)
  • Propeptide:  MAVLMTVLAYCQPASAAATAVTDDDELMARQTRGLVLRSWRNAQQQTDHSADKTPSAKVAEPILPSQKEAMVFNGLPISMRLVLLQHLAGYDKRTPNSRAFLGMRGKKSSPPGADALTMEDNQLDDASGWPQGDILPDTYYFGPAPQKKKMHGEKFLGMRGKKMMNGLADGTAFIPNWRERYIYQEPFEKKRAPSSNSFMGMRGKRSESTTPTPNDYQFFNDDIIVDEELPDVDSKVSPRRSQERTPI
  • Signal peptide:  MAVLMTVLAYCQPASA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-E9G1N8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004302_AF2.pdbhor004302_ESM.pdb

Physical Information

Mass: 151218 Formula: C58H96N18O14S2
Absent amino acids: ACDINPQSTVWY Common amino acids: GKM
pI: 10.79 Basic residues: 4
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -85.45 Boman Index: -2301
Half-Life / Aliphatic Index: 1.3 hour Aliphatic Index: 35.45
Instability Index: 6766.36 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21830762
  • Title:  Genomics, Transcriptomics, and Peptidomics of Daphnia Pulex Neuropeptides and Protein Hormones