General Information

  • ID:  hor004292
  • Uniprot ID:  Q60GS9
  • Protein name:  Ci-TK-I
  • Gene name:  TK
  • Organism:  Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis)
  • Family:  Tachykinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ciona (genus), Cionidae (family), Phlebobranchia (order), Ascidiacea (class), Tunicata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  HVRHFYGLM
  • Length:  9(43-51)
  • Propeptide:  MKADQTLSNRLRNVDYQRDDDLRYLDQLQEKRQRDLYEKNKRHVRHFYGLMGKRSIGDQPSIFNERASFTGLMGKRGPIPYGRDSNILNPEPRLPLQDKTYNGDYLFGVPQNDRDAIGPDNVQNDNPVANRMMQAILSTILNKYCDEN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q60GS9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004292_AF2.pdbhor004292_ESM.pdb

Physical Information

Mass: 130225 Formula: C54H78N16O11S
Absent amino acids: ACDEIKNPQSTW Common amino acids: H
pI: 9.35 Basic residues: 3
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: 1.11 Boman Index: -915
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 75.56
Instability Index: 4555.56 Extinction Coefficient cystines: 1490
Absorbance 280nm: 186.25

Literature

  • PubMed ID:  21467196
  • Title:  Peptidomic Analysis of the Central Nervous System of the Protochordate, Ciona Intestinalis: Homologs and Prototypes of Vertebrate Peptides and Novel Peptides