General Information

  • ID:  hor004279
  • Uniprot ID:  Q868G6
  • Protein name:  Tachykinin
  • Gene name:  Atk
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Tachykinin family
  • Source:  Animal
  • Expression:  Strong expression was detected in the queen and forager heads, while weak and almost no significant expression was detected in the nurse and drone heads, respectively.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007610 behavior
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  APMGFYGTRG
  • Length:  10(182-191)
  • Propeptide:  MIIHSIFLLMVSITLVIAEESDNVLFDKRAPTGHQEMQGKQNSASLNSENFGIFKRALMGFQGVRGKKNSIINDVKNELFPEDINKRAPMGFQGMRGKKASFDDEYYKRAPMGFQGMRGKKSLEEILDEIKKKTTRFQDSRSKDVYLIDYPEDYGKRVLSMDGYQNILDKKDELLGEWEKRAPMGFYGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDDYLDYAINPFDYEKRSTDFQDVESGSESFKRA
  • Signal peptide:  MIIHSIFLLMVSITLVIA
  • Modification:  T9 Arginine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Associated with sex-specific or age/division of labor-selective behavio
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q868G6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004279_AF2.pdbhor004279_ESM.pdb

Physical Information

Mass: 121691 Formula: C47H69N13O13S
Absent amino acids: CDEHIKLNQSVW Common amino acids: G
pI: 9.35 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: -28 Boman Index: -767
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 10
Instability Index: 2785 Extinction Coefficient cystines: 1490
Absorbance 280nm: 165.56

Literature

  • PubMed ID:  19576913
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera