General Information

  • ID:  hor004252
  • Uniprot ID:  A0A143WDS4
  • Protein name:  Tachykinin-related peptide 1
  • Gene name:  Tachykinin
  • Organism:  Blattella germanica (German cockroach) (Blatta germanica)
  • Family:  Tachykinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Blattella (genus), Blattellinae (subfamily), Ectobiidae (family), Blaberoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  APSGFLGVR
  • Length:  9(35-43)
  • Propeptide:  MVLPRPRSRVGALVLVTLSLIAVVLCAPEESPKRAPSGFLGVRGKKDSGPDFNSDELNDVLDKRAPAMGFQGVRGKKDQDEELGYDKRGPSMGFHGMRGKKDQQDLLEEYLDKRGPSRGFMGMRGKKDPMDLDFYDKRAPSMGFQGMRGKKDDWEGEDEIYKRAPSMGFQGMRGKKDYFDDDEDEYVKRMGFMGMRGKKEDFEAEDYPEEGIWGEDEETEELNKRAPAGFFGMRGKKVPAAGFFGMRGKKGPSVG
  • Signal peptide:  MVLPRPRSRVGALVLVTLSLIAVVLC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates foregut and hindgut contractions;stimulate food consumption
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: foregut:0.65nm;hindgut:1.15nm
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A143WDS4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004252_AF2.pdbhor004252_ESM.pdb

Physical Information

Mass: 104592 Formula: C41H66N12O11
Absent amino acids: CDEHIKMNQTWY Common amino acids: G
pI: 10.55 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: 54.44 Boman Index: -269
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 86.67
Instability Index: 5168.89 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18178289
  • Title:  Identification of a Tachykinin-Related Peptide With Orexigenic Properties in the German Cockroach