HORDB

ID: hor004245
Uniprot ID: Q6ZXC3
Protein name: Thyroliberin-like
Gene name: TRH
Organism: Gallus gallus (Chicken)
Family: TRH family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0008437 thyrotropin-releasing hormone activity
GO BP: GO:0001692 histamine metabolic process; GO:0009755 hormone-mediated signaling pathway; GO:0014050 negative regulation of glutamate secretion; GO:0014054 positive regulation of gamma-aminobutyric acid secretion; GO:0032024 positive regulation of insulin secretion; GO:0042755 eating behavior
GO CC: GO:0005576 extracellular region; GO:0030141 secretory granule

Sequence: QHL
Length: 3
Propeptide: MPSIQLPVLLLCLTLSGVCLNGRQFPPELSENMGRSSLDDILQRSGSHMLQSVLKKVEKKEEMNKELNMPLPQWLSKRQHPGKRYISDPEKRQHPGKRDVEEKASFGDIQKRQHLGKTEVEGYLVNYLELKKRQHPGRRSLWDQSTDISSSQLTYLNELSKRQHPGRRYLMYKHQHPSKRGWNDELDLSDQNWEKHQQFGNRDRDSDSPDYTGPCDLQQSAICNKDSLLLDLAEKFSKEGVEEKHQHPGRRSAWENETEE
Signal peptide: MPSIQLPVLLLCLTLSGVCLNGRQ
Modification: T1 Pyrrolidone carboxylic acid;T3 Leucine amide
Glycosylation: NA
Mutagenesis: NA

Function: Functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004245_AF2.pdb

hor004245_ESM.pdb

Mass:	43231	Formula:	C17H28N6O5
Absent amino acids:	ACDEFGIKMNPRSTVWY	Common amino acids:	HLQ
pI:	7.55	Basic residues:	1
Polar residues:	0	Hydrophobic residues:	1
Hydrophobicity:	-96.67	Boman Index:	-528
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	130
Instability Index:	666.67	Extinction Coefficient cystines:	0
Absorbance 280nm:	0