General Information

  • ID:  hor004156
  • Uniprot ID:  P49188
  • Protein name:  Corticoliberin
  • Gene name:  CRH
  • Organism:  Xenopus laevis (African clawed frog)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  animal
  • Expression:  hypothalamus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  AEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII
  • Length:  41
  • Propeptide:  MKFQLWVSTGILLVSLLPCHECRAFIKSPASSPGALLPALSNSQPFLLRMGEEYFLRLGNLHKHSPGSFPEASAGNFVRAVQQLQAQQWSSQPGMRAASLDGADSPYSAQEDPTEKAKRAEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDIIGK
  • Signal peptide:  MKFQLWVSTGILLVSLLPCHECRA
  • Modification:  T41 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulates the release of corticotropin from pituitary gland
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P49188-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004156_AF2.pdbhor004156_ESM.pdb

Physical Information

Mass: 544215 Formula: C207H341N59O63S2
Absent amino acids: CGWY Common amino acids: L
pI: 4.83 Basic residues: 6
Polar residues: 4 Hydrophobic residues: 17
Hydrophobicity: -17.56 Boman Index: -7378
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 114.39
Instability Index: 4307.32 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  1448118
  • Title:  Characterization of the Genomic Corticotropin-Releasing Factor (CRF) Gene From Xenopus Laevis: Two Members of the CRF Family Exist in Amphibians