General Information

  • ID:  hor004148
  • Uniprot ID:  Q95MI6
  • Protein name:  Corticoliberin
  • Gene name:  CRH
  • Organism:  Bos taurus (Bovine)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  animal
  • Expression:  Produced by the hypothalamus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0017045 corticotropin-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0032811 negative regulation of epinephrine secretion; GO:0051464 positive regulation of cortisol secretion; GO:0070093 negative regulation of glucagon secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA
  • Length:  41
  • Propeptide:  MRLRLLVSVGVLLVALLPSPPCRALLSRGPIPGARQASQHPQPLSFFQPPPQPQEPQALPTLLRVGEEYFLRLGNLDETRAAPLSPAASPLASRSSSRLSPDKVAANFFRALLQPRRPFDSPAGPAERGTENALGSRQEAPAARKRRSQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIAGK
  • Signal peptide:  MRLRLLVSVGVLLVALLPSPPCRA
  • Modification:  T41 Alanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone regulating the release of corticotropin from pituitary gland. Induces NLRP6 in intestinal epithelial cells, hence may influence gut microbiota profile
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CRHR2
  • Target Unid:  F1MFI6
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q95MI6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004148_AF2.pdbhor004148_ESM.pdb

Physical Information

Mass: 541207 Formula: C206H339N59O64S
Absent amino acids: CGWY Common amino acids: L
pI: 5.52 Basic residues: 6
Polar residues: 6 Hydrophobic residues: 16
Hydrophobicity: -38.78 Boman Index: -7842
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 111.95
Instability Index: 3981.22 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA