General Information

  • ID:  hor004144
  • Uniprot ID:  NA
  • Protein name:  Corticotropin-releasing factor
  • Gene name:  NA
  • Organism:  NA
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  SEEPPISLDLTFHLLRELEMARAEQLAQQAHSNRKLMENF
  • Length:  40
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  T40 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004144_AF2.pdbhor004144_ESM.pdb

Physical Information

Mass: 539014 Formula: C204H327N59O64S2
Absent amino acids: CGVWY Common amino acids: L
pI: 4.86 Basic residues: 6
Polar residues: 6 Hydrophobic residues: 14
Hydrophobicity: -61 Boman Index: -9462
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 88
Instability Index: 4495.75 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  3010325
  • Title:  Purification and Characterization of Peptides With Corticotropin-Releasing Factor Activity From Porcine Hypothalami