General Information

  • ID:  hor004142
  • Uniprot ID:  P83860
  • Protein name:  QRF-amide
  • Gene name:  QRFP
  • Organism:  Rattus norvegicus (Rat)
  • Family:  RFamide neuropeptide family
  • Source:  animal
  • Expression:  Expressed in the brain with highest expression levels in the hypothalamus and optic nerve. Also expressed in the trachea and mammary gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005184 neuropeptide hormone activity; GO:0031854 orexigenic neuropeptide QRFP receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007625 grooming behavior; GO:0007626 locomotory behavior; GO:0045777 positive regulation of blood pressure; GO:0060259 regulation of feeding behavior
  • GO CC:  GO:0005575 cellular_component; GO:0005576 extracellular region

Sequence Information

  • Sequence:  QDSGSEATGFLPTDSEKASGPLGTLAEELSSYSRRKGGFSFRF
  • Length:  43
  • Propeptide:  MRCLCSWLCLLLPLSACFPLLDRRGPTDIGDIGARMSWVQLTEGHTPRSVQSPRPQALLVVAKEQQASRREHTGFRLGRQDSGSEATGFLPTDSEKASGPLGTLAEELSSYSRRKGGFSFRFGR
  • Signal peptide:  MRCLCSWLCLLLPLSAC
  • Modification:  T1 Pyrrolidone carboxylic acid;T43 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates feeding behavior, metabolic rate and locomotor activity and increases blood pressure. May have orexigenic activity. May promote aldosterone secretion by the adrenal gland
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Qrfpr
  • Target Unid:  P83858
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P83860-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004142_AF2.pdbhor004142_ESM.pdb

Physical Information

Mass: 532122 Formula: C199H305N55O69
Absent amino acids: CHIMNVW Common amino acids: S
pI: 4.77 Basic residues: 5
Polar residues: 18 Hydrophobic residues: 11
Hydrophobicity: -68.37 Boman Index: -9846
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 43.26
Instability Index: 6344.88 Extinction Coefficient cystines: 1490
Absorbance 280nm: 35.48

Literature

  • PubMed ID:  16648250
  • Title:  A Neuropeptide Ligand of the G Protein-Coupled Receptor GPR103 Regulates Feeding, Behavioral Arousal, and Blood Pressure in Mice