General Information

  • ID:  hor004139
  • Uniprot ID:  P83862
  • Protein name:  QRF-amide
  • Gene name:  QRFP
  • Organism:  Bos taurus (Bovine)
  • Family:  RFamide neuropeptide family
  • Source:  animal
  • Expression:  Expressed in the hypothalamus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0031854 orexigenic neuropeptide QRFP receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007626 locomotory behavior; GO:0045777 positive regulation of blood pressure; GO:0060259 regulation of feeding behavior
  • GO CC:  GO:0005575 cellular_component; GO:0005576 extracellular region

Sequence Information

  • Sequence:  QDDGSEATGLLLGEAEKVGGLLGTLAEELNGYSRKKGGFSFRF
  • Length:  43
  • Propeptide:  MRSPYSLPYLLFLPLGACFPVLDTEEPVDAVGGTGREMSWMDPARGRPFPWGSPGWPRAPYPHALLVTAKELRASGKARAGFQLRLGRQDDGSEATGLLLGEAEKVGGLLGTLAEELNGYSRKKGGFSFRFGRR
  • Signal peptide:  MRSPYSLPYLLFLPLGAC
  • Modification:  T43 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates feeding behavior, metabolic rate and locomotor activity and increases blood pressure. May have orexigenic activity. May promote aldosterone secretion by the adrenal gland
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P83862-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004139_AF2.pdbhor004139_ESM.pdb

Physical Information

Mass: 526834 Formula: C199H314N54O66
Absent amino acids: CHIMPW Common amino acids: G
pI: 4.48 Basic residues: 5
Polar residues: 16 Hydrophobic residues: 14
Hydrophobicity: -37.91 Boman Index: -6433
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 77.21
Instability Index: 1943.02 Extinction Coefficient cystines: 1490
Absorbance 280nm: 35.48

Literature

  • PubMed ID:  NA
  • Title:  NA