General Information

  • ID:  hor004138
  • Uniprot ID:  Q99P87
  • Protein name:  Resistin
  • Gene name:  Retn
  • Organism:  Mus musculus (Mouse)
  • Family:  Resistin/FIZZ family
  • Source:  Animal
  • Expression:  Expressed in white but not brown adipose tissue in a variety of organs.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0010714 positive regulation of collagen metabolic process; GO:0014911 positive regulation of smooth muscle cell migration; GO:0032868 response to insulin; GO:0045444 fat cell differentiation; GO:0048661 positive regulation of smooth muscle cell proliferation; GO:0050806 positive regulation of synaptic transmission; GO:2000252 negative regulation of feeding behavior; GO:2000872 positive regulation of progesterone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
  • Length:  94(21-114)
  • Propeptide:  MKNLSFPLLFLFFLVPELLGSSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
  • Signal peptide:  MKNLSFPLLFLFFLVPELLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  6-6; 35-88; 47-87; 56-73; 58-75; 62-77
  • Structure ID:  1rfx(PDB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    1rfx.pdbhor004138_AF2.pdbhor004138_ESM.pdb

Physical Information

Mass: 1182983 Formula: C432H697N125O134S12
Absent amino acids: Y Common amino acids: CS
pI: 7.82 Basic residues: 12
Polar residues: 34 Hydrophobic residues: 31
Hydrophobicity: -4.47 Boman Index: -13183
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 75.85
Instability Index: 5011.49 Extinction Coefficient cystines: 17125
Absorbance 280nm: 184.14

Literature

  • PubMed ID:  NA
  • Title:  NA