General Information

  • ID:  hor004137
  • Uniprot ID:  Q9BQ08
  • Protein name:  Resistin-like beta
  • Gene name:  RETNLB
  • Organism:  Homo sapiens (Human)
  • Family:  Resistin/FIZZ family
  • Source:  Human
  • Expression:  Expressed only in the gastrointestinal tract, particularly the colon.
  • Disease:  Diseases associated with RETNLB include Ileitis and Parasitic Helminthiasis Infectious Disease.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function; GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050673 epithelial cell proliferation
  • GO CC:  GO:0005575 cellular_component; GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
  • Length:  88(24-111)
  • Propeptide:  MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
  • Signal peptide:  MGPSSCLLLILIPLLQLINPGST
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-2; 32-85; 44-84; 53-70; 55-72; 59-74
  • Structure ID:  AF-Q9BQ08-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004137_AF2.pdbhor004137_ESM.pdb

Physical Information

Mass: 1090575 Formula: C390H629N111O129S13
Absent amino acids: F Common amino acids: S
pI: 7.54 Basic residues: 10
Polar residues: 39 Hydrophobic residues: 22
Hydrophobicity: -8.07 Boman Index: -11261
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 64.2
Instability Index: 4446.14 Extinction Coefficient cystines: 14605
Absorbance 280nm: 167.87

Literature

  • PubMed ID:  11201732
  • Title:  The hormone resistin links obesity to diabetes.
  • PubMed ID:  15064728
  • Title:  Identification of murine and human XCP1 genes as C/EBP-epsilon-dependent members of FIZZ/Resistin gene family.
  • PubMed ID:  15248836
  • Title:   Identification of murine and human XCP1 genes as C/EBP-epsilon-dependent members of FIZZ/Resi