General Information

  • ID:  hor004136
  • Uniprot ID:  Q9HD89
  • Protein name:  Resistin
  • Gene name:  Retn
  • Organism:  Homo sapiens (Human)
  • Family:  Resistin/FIZZ family
  • Source:  Human
  • Expression:  Expressed in white adipose tissue (at protein level) .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0007165 signal transduction; GO:0008150 biological_process; GO:0009612 response to mechanical stimulus; GO:0032868 response to insulin; GO:0045444 fat cell differentiation; GO:0050806 positive regulation of synaptic transmission; GO:2000252 negative regulation of feeding behavior; GO:2000872 positive regulation of progesterone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0035578 azurophil granule lumen; GO:0035580 specific granule lumen; GO:0070062 extracellular exosome

Sequence Information

  • Sequence:  KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
  • Length:  90(19-108)
  • Propeptide:  MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
  • Signal peptide:  MKALCLLLLPVLGLLVSS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes. Promotes chemotaxis in myeloid cells
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  4-4; 33-86; 45-85; 54-71; 56-73; 60-75
  • Structure ID:  AF-Q9HD89-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004136_AF2.pdbhor004136_ESM.pdb

Physical Information

Mass: 1114160 Formula: C393H637N121O130S13
Absent amino acids: Y Common amino acids: C
pI: 5.76 Basic residues: 9
Polar residues: 37 Hydrophobic residues: 27
Hydrophobicity: 4 Boman Index: -13960
Half-Life / Aliphatic Index: 1.3 hour Aliphatic Index: 65.11
Instability Index: 3447.78 Extinction Coefficient cystines: 11625
Absorbance 280nm: 130.62

Literature

  • PubMed ID:  NA
  • Title:  NA