General Information

  • ID:  hor004073
  • Uniprot ID:  P11159
  • Protein name:  Pheromone biosynthesis-activating neuropeptide
  • Gene name:  NA
  • Organism:  Helicoverpa zea (Corn earworm moth) (Heliothis zea)
  • Family:  Pyrokinin family
  • Source:  Animal
  • Expression:  Expressed in the subesophageal ganglions. Not found in corpora cardiaca, corpora allata and thoracic ganglia.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Helicoverpa (genus), Heliothinae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0019236 response to pheromone; GO:0042811 pheromone biosynthetic process
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL
  • Length:  33(127-159)
  • Propeptide:  MFNQTQLFVFLAVFTTSSVLGNNNDVKDGAASGAHSDRLGLWFGPRLGKRSLRISTEDNRQAFFKLLEAADALKYYYDQLPYEMQADEPETRVTKKVIFTPKLGRSLAYDDKSFENVEFTPRLGRRLSDDMPATPADQEMYRQDPEQIDSRTKYFSPRLGRTMNFSPRLGRELSYDMMPNKIRVVRSTNKTRST
  • Signal peptide:  MFNQTQLFVFLAVFTTSSVLGNN
  • Modification:  T33 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  A hormone that controls sex pheromone production in females and pheromone responsiveness in male. Also mediates visceral muscle contractile activity
  • Mechanism:  Juvenile hormone seems to allow PBAN release, which then induces pheromone biosynthesis.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P11159-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004073_AF2.pdbhor004073_ESM.pdb

Physical Information

Mass: 447323 Formula: C167H258N46O58S2
Absent amino acids: CGHNVW Common amino acids: D
pI: 4.14 Basic residues: 4
Polar residues: 7 Hydrophobic residues: 6
Hydrophobicity: -130 Boman Index: -11371
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 41.52
Instability Index: 8547.88 Extinction Coefficient cystines: 2980
Absorbance 280nm: 93.13

Literature

  • PubMed ID:  17802237
  • Title:  Identification of a neuropeptide hormone that regulates sex pheromone production in female moths.